{"product_id":"proteintech-14402-1-ap","title":"Proteintech, 14402-1-AP, CLCNKA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CLCNKA (14402-1-AP) by Proteintech is a Polyclonal antibody targeting CLCNKA in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n14402-1-AP targets CLCNKA in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, human kidney tissue,  mouse pancreas tissue,  mouse kidney tissue\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human kidney tissue, human placenta tissue,  human testis tissue,  human skin tissue,  human spleen tissue,  human lung tissue,  human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:400-1:1000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5647 Product name: Recombinant human CLCNKA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 515-687 aa of BC048282 Sequence: CQPSFYDGTIIVKKLPYLPRILGRNIGSHHVRVEHFMNHSITTLAKDTPLEEVVKVVTSTDVTEYPLVESTESQILVGIVQRAQLVQALQAEPPSRAPGHQQCLQDILARGCPTEPVTLTLFSETTLHQAQNLFKLLNLQSLFVTSRGRAVGCVSWVEMKKAISNLTNPPAPK Predict reactive species\nFull Name: chloride channel Ka\nCalculated Molecular Weight: 75 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC048282\nGene Symbol: CLCNKA\nGene ID (NCBI): 1187\nRRID: AB_2079857\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P51800\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886595887273,"sku":"14402-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14402-1-ap","provider":"Iright","version":"1.0","type":"link"}