{"product_id":"proteintech-14446-1-ap","title":"Proteintech, 14446-1-AP, RSK3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RSK3 (14446-1-AP) by Proteintech is a Polyclonal antibody targeting RSK3 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n14446-1-AP targets RSK3 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells,  HeLa cells,  MCF-7 cells,  MDA-MB-231 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human lung cancer tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRSK3, also named as RPS6KA2, belongs to the protein kinase superfamily. RSK3 is a serine\/threonine-protein kinase that acts downstream of ERK (MAPK1\/ERK2 and MAPK3\/ERK1) signaling and mediates mitogenic and stress-induced activation of transcription factors, regulates translation, and mediates cellular proliferation, survival, and differentiation. In addition RSK3 may function as tumor suppressor in epithelial ovarian cancer cells(Uniprot). The molecular weight of RSK3 is 83 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5862 Product name: Recombinant human RPS6KA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 66-311 aa of BC002363 Sequence: GQGSYGKVFLVRKVKGSDAGQLYAMKVLKKATLKVRDRVRSKMERDILAEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDEEGHIKITDFGLSKEAIDHDKRAYSFCGTIEYMAPEVVNRRGHTQSADWWSFGVLMFEMLTGSLPFQGKDRKETMALILKAKLGMPQFLSGEAQSLLRALFKRNPCNRLGAGIDGVEE Predict reactive species\nFull Name: ribosomal protein S6 kinase, 90kDa, polypeptide 2\nCalculated Molecular Weight: 83 kDa\nObserved Molecular Weight: 83 kDa\nGenBank Accession Number: BC002363\nGene Symbol: RSK3\nGene ID (NCBI): 6196\nRRID: AB_2285316\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15349\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869009629353,"sku":"14446-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14446-1-ap","provider":"Iright","version":"1.0","type":"link"}