{"product_id":"proteintech-14454-1-ap","title":"Proteintech, 14454-1-AP, FANCL Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FANCL (14454-1-AP) by Proteintech is a Polyclonal antibody targeting FANCL in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n14454-1-AP targets FANCL in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HEK-293 cells,  HEK-cells,  Hela cells,  HepG2 cells\nPositive IHC detected in: human kidney tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFanconi anemia (FA) is a hereditary bone marrow failure syndrome associated with developmental defects and cancer predisposition. The FA nuclear core complex consists of FANCA, B, C, E, F, G, L, and M. FANCL is a RING-type E3 ubiquitin ligase that monoubiquitinates FANCD2 and FANCI, a key functional role facilitated by other members of the nuclear core complex (PMID: 23783032). FANCL plays an important role in the repair of cisplatin-induced DNA damage (PMID: 26385482) and participates directly in support of stem cell function (PMID: 23783032). FANCL can be detected as 40-43 kDa (full-length) and ~28 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6031 Product name: Recombinant human FANCL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-375 aa of BC054517 Sequence: MAVTEASLLRQCPLLLPQNRSKTVYEGFISAQGRDFHLRIVLPEDLQLKNARLLCSWQLRTILSGYHRIVQQRMQHSPDLMSFMMELKMLLEVALKNRQELYALPPPPQFYSSLIEEIGTLGWDKLVYADTCFSTIKLKAEDASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQSSLISIYSQFLAAIESLKAFWDVMDEIDEKTWVLEPEKPPRSATARRIALGNNVSINIEVDPRHPTMLPECFFLGADHVVKPLGIKLSRNIHLWDPENSVLQNLKDVLEIDFPARAILEKSDFTMDCGICYAYQLDGTIPDQVCDNSQCGQPFHQICLYEWLRGLLTSRQSFNIIFGECPYCSKPITLKMSGRKH Predict reactive species\nFull Name: Fanconi anemia, complementation group L\nCalculated Molecular Weight: 43 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC054517\nGene Symbol: FANCL\nGene ID (NCBI): 55120\nRRID: AB_10644333\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NW38\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887634993321,"sku":"14454-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14454-1-ap","provider":"Iright","version":"1.0","type":"link"}