{"product_id":"proteintech-14502-1-ap","title":"Proteintech, 14502-1-AP, GSTM5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GSTM5 (14502-1-AP) by Proteintech is a Polyclonal antibody targeting GSTM5 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n14502-1-AP targets GSTM5 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, rat skeletal muscle tissue,  mouse testis\nPositive IP detected in: mouse skeletal muscle tissue\nPositive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGSTM5 belongs to the GST superfamily that metabolizes a broad range of xenobiotics and carcinogens. GSTM5 is expressed in brain, testis, lung and a lesser extent in heart.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5958 Product name: Recombinant human GSTM5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-218 aa of BC058881 Sequence: MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGETEEEKIRVDILENQVMDNHMELVRLCYDPDFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK Predict reactive species\nFull Name: glutathione S-transferase mu 5\nCalculated Molecular Weight: 26 kDa\nObserved Molecular Weight: 26 kDa\nGenBank Accession Number: BC058881\nGene Symbol: GSTM5\nGene ID (NCBI): 2949\nRRID: AB_2263888\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P46439\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868998848681,"sku":"14502-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14502-1-ap","provider":"Iright","version":"1.0","type":"link"}