{"product_id":"proteintech-14517-1-ap","title":"Proteintech, 14517-1-AP, USP14 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe USP14 (14517-1-AP) by Proteintech is a Polyclonal antibody targeting USP14 in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n14517-1-AP targets USP14 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: DU 145 cells, HeLa cells,  mouse heart tissue,  HEK-293T cells,  HEK-293 cells,  SKOV-3 cells,  Neuro-2a cells\nPositive IP detected in: mouse liver tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:18000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUSP14(Ubiquitin carboxyl-terminal hydrolase 14) is also named as TGT and belongs to the peptidase C19 family. Mammalian USP14 is unique among known UBP enzymes in that it is activated catalytically upon specific association with the 26S proteasome. USP14 inhibition accelerated the degradation of oxidized proteins and enhanced resistance to oxidative stress.This protein has a 45-kDa catalytic domain (PMID:16211010).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5979 Product name: Recombinant human USP14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-294 aa of BC003556 Sequence: MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNIKIKNGMTLLMMGSADALPEEPSAKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRL Predict reactive species\nFull Name: ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase)\nCalculated Molecular Weight: 54 kDa\nObserved Molecular Weight: 52-60 kDa\nGenBank Accession Number: BC003556\nGene Symbol: USP14\nGene ID (NCBI): 9097\nRRID: AB_2257124\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P54578\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868859617449,"sku":"14517-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14517-1-ap","provider":"Iright","version":"1.0","type":"link"}