{"product_id":"proteintech-14518-1-ap","title":"Proteintech, 14518-1-AP, ENSA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ENSA (14518-1-AP) by Proteintech is a Polyclonal antibody targeting ENSA in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n14518-1-AP targets ENSA in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, COLO 320 cells,  HeLa cells\nPositive IHC detected in: human small intestine tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEndosulfine alpha (ENSA) belongs to the highly conserved c-AMP-regulated phosphoprotein (ARPP) family and was originally identified as an endogenous ligand for the sulfonylurea receptor, which regulates insulin secretion and glucose metabolism.ENSA not only regulates the cell cycle by interacting with microtubule-associated serine\/threonine protein kinase-like (MASTL) enzymes, but also influences tumor growth through its own methylation. Recent studies have shown that ENSA is an important regulator of cholesterol biosynthesis in triple-negative breast cancer (TNBC) and that it triggers tumor growth by promoting cholesterol biosynthesis in TNBC.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5982 Product name: Recombinant human ENSA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-121 aa of BC004461 Sequence: MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE Predict reactive species\nFull Name: endosulfine alpha\nCalculated Molecular Weight: 14 kDa\nObserved Molecular Weight: 19 kDa\nGenBank Accession Number: BC004461\nGene Symbol: ENSA\nGene ID (NCBI): 2029\nRRID: AB_10838808\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43768\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869678915753,"sku":"14518-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14518-1-ap","provider":"Iright","version":"1.0","type":"link"}