{"product_id":"proteintech-14534-1-ap","title":"Proteintech, 14534-1-AP, CASZ1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CASZ1 (14534-1-AP) by Proteintech is a Polyclonal antibody targeting CASZ1 in WB, ELISA applications with reactivity to human, mouse samples\n14534-1-AP targets CASZ1 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SMMC-7721 cells, C2C12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZinc finger protein castor homolog 1 (CASZ1), also known as zinc finger protein 693 (ZNF693), belongs to the C2H2-type zinc finger protein family. CASZ1 is a transcription factor that is evolutionarily conserved and participates in multiple embryonic development and physiological processes. CASZ1 has been found to regulate aldosterone synthesis and repress the activation of aldosterone target genes, suggesting that it may participate in blood pressure regulation. CASZ1 is ubiquitously expressed in various embryonic tissues. Subcellularly, CASZ1 is usually localized in the cell nucleus, consistent with its role in transcription regulation (PMID: 37509718). CASZ1 has two isoforms namely CASZ1a (i.e., hcasz11, 190 kDa) and CASZ1b (i.e., hcasz5, 125 kDa). The observed molecular weights were 150 kDa and 250 kDa, respectively, consistent with descriptions in the literature (PMID: 32060262).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6035 Product name: Recombinant human CASZ1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 818-1166 aa of BC051883 Sequence: PSLLGAVSSGSAASATPDTPTLVASGAGDSAPVAAASVPAPPASIMERISASKGLISPMMARLAAAALKPSATFDPGSGQQVTPARFPPAQVKPEPGESTGAPGPHEASQDRSLDLTVKEPSNESNGHAVPANSSLLSSLMNKMSQGNPGLGSLLNIKAEAEGSPAAEPSPFLGKAVKALVQEKLAEPWKVYLRRFGTKDFCDGQCDFLHKAHFHCVVEECGALFSTLDGAIKHANFHFRTEGGAAKGNTEAAFPASAAETKPPMAPSSPPVPPVTTATVSSLEGPAPSPASVPSTPTLLAWKQLASTIPQMPQIPASVPHLPASPLATTSLENAKPQVKPGFLQFQEK Predict reactive species\nFull Name: castor zinc finger 1\nCalculated Molecular Weight: 190 kDa\nObserved Molecular Weight: 150 kDa, 250 kDa\nGenBank Accession Number: BC051883\nGene Symbol: CASZ1\nGene ID (NCBI): 54897\nRRID: AB_3669188\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86V15\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885841305769,"sku":"14534-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14534-1-ap","provider":"Iright","version":"1.0","type":"link"}