{"product_id":"proteintech-14543-1-ap","title":"Proteintech, 14543-1-AP, LZIC Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LZIC (14543-1-AP) by Proteintech is a Polyclonal antibody targeting LZIC in WB, ELISA applications with reactivity to human samples\n14543-1-AP targets LZIC in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BxPC-3 cells, HepG2 cells,  HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLZIC is closely related to ICAT, a physiological inhibitor of the Wnt pathway that interacts physically and functionally with β-catenin to prevent the transcription of Wnt target genes. LZIC's ICAT-homologous region is highly similar to ICAT with particular conservation of residues that are used by ICAT for β-catenin-binding. LZIC does not interact with β-catenin in vitro or in vivo. LZIC is a protein conserved in vertebrates, is required for neuronal survival.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6047 Product name: Recombinant human LZIC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-190 aa of BC063443 Sequence: MASRGKTETSKLKQNLEEQLDRLMQQLQDLEECREELDTDEYEETKKETLEQLSEFNDSLKKIMSGNMTLVDELSGMQLAIQAAISQAFKTPEVIRLFAKKQPGQLRTRLAEMDRDLMVGKLERDLYTQQKVEILTALRKLGEKLTADDEAFLSANAGAILSQFEKVSTDLGSGDKILALASFEVEKTKK Predict reactive species\nFull Name: leucine zipper and CTNNBIP1 domain containing\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 21-24 kDa\nGenBank Accession Number: BC063443\nGene Symbol: LZIC\nGene ID (NCBI): 84328\nRRID: AB_2138923\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WZA0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887710490793,"sku":"14543-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14543-1-ap","provider":"Iright","version":"1.0","type":"link"}