{"product_id":"proteintech-14550-1-ap","title":"Proteintech, 14550-1-AP, AFP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AFP (14550-1-AP) by Proteintech is a Polyclonal antibody targeting AFP in WB, IHC, IP, ELISA applications with reactivity to human samples\n14550-1-AP targets AFP in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BxPC-3 cells, HepG2 cells,  HuH-7 cells,  L02 cells,  HepG2cells,  human placenta tissue\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human ovary cancer tissue, human liver cancer tissue,  human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAFP (Alpha-fetoprotein) is a major plasma protein in the fetus and its concentration is very low in the adult (PMID:24120489). AFP can be detected at abnormally high concentrations in hepatocellular carcinomas as well as in the plasma and ascitic fluid of adults with hepatoma, indicating that AFP can serve as a tumor marker (PMID: 18669658). AFP is also a glycosylated protein and based on its binding capability to lectin Lens Culinaris Agglutinin (LCA), and total AFP can be separated into three different glycoforms, AFP-L1, AFP-L2, and AFP-L3. Core-fucosylated form of AFP (AFP-L3) is a more specific indicator than total AFP for HCC (PMID: 33128033, 35458505)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6089 Product name: Recombinant human AFP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 260-609 aa of BC027881 Sequence: LDVAHVHEHCCRGDVLDCLQDGEKIMSYICSQQDTLSNKITECCKLTTLERGQCIIHAENDEKPEGLSPNLNRFLGDRDFNQFSSGEKNIFLASFVHEYSRRHPQLAVSVILRVAKGYQELLEKCFQTENPLECQDKGEEELQKYIQESQALAKRSCGLFQKLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEDKLLACGEGAADIIIGHLCIRHEMTPVNPGVGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV Predict reactive species\nFull Name: alpha-fetoprotein\nCalculated Molecular Weight: 69 kDa\nObserved Molecular Weight: 68-72 kDa\nGenBank Accession Number: BC027881\nGene Symbol: AFP\nGene ID (NCBI): 174\nRRID: AB_2223933\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P02771\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868825964713,"sku":"14550-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14550-1-ap","provider":"Iright","version":"1.0","type":"link"}