{"product_id":"proteintech-14584-1-ap","title":"Proteintech, 14584-1-AP, L-Myc Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe L-Myc (14584-1-AP) by Proteintech is a Polyclonal antibody targeting L-Myc in WB, ELISA applications with reactivity to human samples\n14584-1-AP targets L-Myc in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NCI-H1299 cells, U266 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe MYC gene family consists of 3 members, C-MYC, L-MYC, and N-MYC, all of which belong to the superfamily of basic helix-loop-helix leucine zipper (bHLHLZ) DNA binding proteins. L-MYC encodes a nuclear phosphoprotein with 364 amino acids, heterodimerizing with partner protein Max and acts as a transcription factor to control the expression of target genes. L-Myc is involved in many biological processes, including cell proliferation, differentiation, apoptosis and has been found to be amplified and over-expressed in some malignancies. L-Myc amplification has been reported in small-cell lung cancer (PMID: 25528583, 33524794). The observed molecular weight of L-Myc is 68 kDa, which is consistent with the description in the literature (PMID: 8657155).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6105 Product name: Recombinant human MYCL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-206 aa of BC011864 Sequence: MDYDSYQHYFYDYDCGEDFYRSTAPSEDIWKKFELVPSPPTSPPWGLGPGAGDPAPGIGPPEPWPGGCTGDEAESRGHSKGWGRNYASIIRRDCMWSGFSARERLERAVSDRLAPGAPRGNPPKASAAPDCTPSLEAGNPAPAAPCPLGEPKTQACSGSESPSDSGKDLPEPSKRGPPHGWPKLCPCLRSGIGSSQALGPSPPLFG Predict reactive species\nFull Name: v-myc myelocytomatosis viral oncogene homolog 1, lung carcinoma derived (avian)\nCalculated Molecular Weight: 40 kDa\nObserved Molecular Weight: 68 kDa\nGenBank Accession Number: BC011864\nGene Symbol: MYCL1\nGene ID (NCBI): 4610\nRRID: AB_3669190\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P12524\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869703852201,"sku":"14584-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14584-1-ap","provider":"Iright","version":"1.0","type":"link"}