{"product_id":"proteintech-14586-1-ap","title":"Proteintech, 14586-1-AP, ERCC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ERCC1 (14586-1-AP) by Proteintech is a Polyclonal antibody targeting ERCC1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n14586-1-AP targets ERCC1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, human kidney tissue,  MCF-7 cells,  MDA-MB-231 cells,  SKOV-3 cells,  T-47D cells\nPositive IP detected in: MCF-7 cells\nPositive IHC detected in: human testis tissue,  human brain tissue,  human ovary tissue,  human skin tissue,  human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nExcision Repair Cross Complementing 1 (ERCC1) is a structure-specific endonuclease that is responsible for the 5'-incision during DNA repair. It forms a complex with ERCC11, XPF and ERCC4, which are required in both recombinatorial repair and nucleotide excision repair. It has been found that ERCC1, together with RRM1, are determinants of survival after surgical treatment of early-stage, non-small-cell lung cancer.  (Ref: Simon, ER. 2005). The calculated molecular weight of ERCC1 is 33 kDa, but the modified ERCC1 is about38 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6112 Product name: Recombinant human ERCC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-323 aa of BC052813 Sequence: MDPGKDKEGVPQPSGPPARKKFVIPLDEDEVPPGVAKPLFRSTQSLPTVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKVRALGKNPRSWGKERAPNKHNLRPQSFKVKKEPKTRHSGFRL Predict reactive species\nFull Name: excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence)\nCalculated Molecular Weight: 33 kDa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: BC052813\nGene Symbol: ERCC1\nGene ID (NCBI): 2067\nRRID: AB_2100027\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P07992\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868878885033,"sku":"14586-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14586-1-ap","provider":"Iright","version":"1.0","type":"link"}