{"product_id":"proteintech-14588-1-ap","title":"Proteintech, 14588-1-AP, NRARP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NRARP (14588-1-AP) by Proteintech is a Polyclonal antibody targeting NRARP in IHC, IF\/ICC, ELISA applications with reactivity to human samples\n14588-1-AP targets NRARP in IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNRARP, Notch-regulated ankyrin repeat-containing protein, acts as a downstream effector of Notch signaling, involved in angiogenesis acting downstream of Notch at branch points to regulate vascular density. NRARP is also involved in the regulation of liver cancer cells self-renewal (PMID: 25985737, PMID: 19154719). During somitogenesis, it is involved in maintenance of proper somite segmentation and proper numbers of somites and vertebrae.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6114 Product name: Recombinant human NRARP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-114 aa of BC053618 Sequence: MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDGWSALHIAAFGGHQDIVLYLITKAKYAASGR Predict reactive species\nFull Name: NOTCH-regulated ankyrin repeat protein\nCalculated Molecular Weight: 12 kDa\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: BC053618\nGene Symbol: NRARP\nGene ID (NCBI): 441478\nRRID: AB_3085438\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7Z6K4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887742079145,"sku":"14588-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14588-1-ap","provider":"Iright","version":"1.0","type":"link"}