{"product_id":"proteintech-14594-1-ap","title":"Proteintech, 14594-1-AP, RAB11FIP5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAB11FIP5 (14594-1-AP) by Proteintech is a Polyclonal antibody targeting RAB11FIP5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n14594-1-AP targets RAB11FIP5 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HEK-293T cells,  HeLa cells,  mouse heart tissue,  mouse kidney tissue,  rat heart tissue,  Jurkat cells,  mouse lung tissue\nPositive IHC detected in: human cervical cancer tissue, mouse colon tissue,  mouse kidney tissue,  rat colon tissue,  rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRab11 family-interacting protein 5 (Rab11fip5) is an adaptor protein that binds to the small GTPase Rab11, which has an important function in endosome recycling and trafficking of cellular proteins to the plasma membrane. Rab11fip5 is involved in many cellular processes, such as cytoskeleton rearrangement, iron uptake and exocytosis in neuroendocrine cells, and is also known as a candidate gene for autism-spectrum disorder.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6128 Product name: Recombinant human RAB11FIP5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-250 aa of BC035013 Sequence: MALVRGAEPAAGPSRWLPTHVQVTVLRARGLRGKSSGAGSTSDAYTVIQVGREKYSTSVVEKTHGCPEWREECSFELPPGALDGLLRAQEADAGPAPWAASSAAACELVLTTMHRSLIGVDKFLGQATVALDEVFGAGRAQHTQWYKLHSKPGKKEKERGEIEVTIQFTRNNLSAMFDLSMKDKPRSPFSKIRDKMKGKKKYDLESASAILPSSAIEDPDLGSLGKMGKAKGFFLRNKLRKSSLTQSNTS Predict reactive species\nFull Name: RAB11 family interacting protein 5 (class I)\nCalculated Molecular Weight: 70 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC035013\nGene Symbol: RAB11FIP5\nGene ID (NCBI): 26056\nRRID: AB_10860101\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BXF6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869425815721,"sku":"14594-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14594-1-ap","provider":"Iright","version":"1.0","type":"link"}