{"product_id":"proteintech-14642-1-ap","title":"Proteintech, 14642-1-AP, IGF2BP3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IGF2BP3 (14642-1-AP) by Proteintech is a Polyclonal antibody targeting IGF2BP3 in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n14642-1-AP targets IGF2BP3 in WB, IHC, IF\/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, BxPC-3 cells,  HeLa cells,  HepG2 cells,  mouse brain tissue,  mouse placenta tissue,  NIH\/3T3 cells\nPositive IP detected in: HEK-293 cells\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:20000-1:100000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIGF2BP3, also named IMP3, KOC1, and VICKZ3, belongs to the RRM IMP\/VICKZ family. It is one of the RNA binding proteins involved in mRNA localization and translational control. IGF2BP3 is expressed during embryogenesis, as well as in some malignant tumors. It can be used as an independent prognostic factor for osteosarcoma. Both isoforms (64kd and 22kd) of IGFBP3 can be recognized by this antibody. And IGFBP3 is nuclear and cytoplasm stains.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6226 Product name: Recombinant human IGF2BP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 240-579 aa of BC065269 Sequence: AEKSITILSTPEGTSAACKSILEIMHKEAQDIKFTEEIPLKILAHNNFVGRLIGKEGRNLKKIEQDTDTKITISPLQELTLYNPERTITVKGNVETCAKAEEEIMKKIRESYENDIASMNLQAHLIPGLNLNALGLFPPTSGMPPPTSGPPSAMTPPYPQFEQSETETVHLFIPALSVGAIIGKQGQHIKQLSRFAGASIKIAPAEAPDAKVRMVIITGPPEAQFKAQGRIYGKIKEENFVSPKEEVKLEAHIRVPSFAAGRVIGKGGKTVNELQNLSSAEVVVPRDQTPDENDQVVVKITGHFYACQVAQRKIQEILTQVKQHQQQKALQSGPPQSRRK Predict reactive species\nFull Name: insulin-like growth factor 2 mRNA binding protein 3\nCalculated Molecular Weight: 64 kDa\nObserved Molecular Weight: 64 kDa\nGenBank Accession Number: BC065269\nGene Symbol: IGF2BP3\nGene ID (NCBI): 10643\nRRID: AB_2122782\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00425\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868824948905,"sku":"14642-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14642-1-ap","provider":"Iright","version":"1.0","type":"link"}