{"product_id":"proteintech-14670-1-ap","title":"Proteintech, 14670-1-AP, HLA-F Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HLA-F (14670-1-AP) by Proteintech is a Polyclonal antibody targeting HLA-F in WB, IHC, IP, ELISA applications with reactivity to human samples\n14670-1-AP targets HLA-F in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells, human placenta tissue,  human spleen tissue,  A431 cells\nPositive IP detected in: A431 cells\nPositive IHC detected in: human tonsillitis tissue, human placenta tissue,  human skin cancer tissue,  human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHuman major histocompatibility complex (MHC) antigens, also referred to as human leukocyte antigens (HLA), are encoded by genes located on the short arm of chromosome 6 (6p21.3). There are two classes of HLA antigens: class I and class II. This class I molecules are membrane glycoproteins composed of a heavy (alpha) chain which is encoded by a HLA class I gene, and β2-microglobulin light (beta) chain. The most extensively characterized members of the HLA class I gene family are the genes encoding the major transplantation antigenes, HLA-A, B and C. HLA-F is a non-classical MHC class I molecule. (PMID: 667938; 3375250; 2249951)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6335 Product name: Recombinant human HLA-F protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-298 aa of BC062991 Sequence: AGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTYLEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPQPLILRWEQS Predict reactive species\nFull Name: major histocompatibility complex, class I, F\nCalculated Molecular Weight: 39 kDa\nObserved Molecular Weight: 40-45 kDa\nGenBank Accession Number: BC062991\nGene Symbol: HLA-F\nGene ID (NCBI): 3134\nRRID: AB_1519280\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P30511\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868934197417,"sku":"14670-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14670-1-ap","provider":"Iright","version":"1.0","type":"link"}