{"product_id":"proteintech-14726-1-ap","title":"Proteintech, 14726-1-AP, SPAG5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPAG5 (14726-1-AP) by Proteintech is a Polyclonal antibody targeting SPAG5 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n14726-1-AP targets SPAG5 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  K-562 cells,  PC-3 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human testis tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSPAG5, also named as MAP126, Astrin and Deepest, is necessary for normal spindle formation during mitosis. It is highly expressed in testis. SPAG5 has different localization in somatic versus male germ cells suggesting the possibility of different function. This antibody is specific to SPAG5.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6485 Product name: Recombinant human SPAG5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 844-1193 aa of BC000322 Sequence: TVENLTAKLASTIADNQEQDLEKTRQYSQKLGLLTEQLQSLTLFLQTKLKEKTEQETLLLSTACPPTQEHPLPNDRTFLGSILTAVADEEPESTPVPLLGSDKSAFTRVASMVSLQPAETPGMEESLAEMSIMTTELQSLCSLLQESKEEAIRTLQRKICELQARLQAQEEQHQEVQKAKEADIEKLNQALCLRYKNEKELQEVIQQQNEKILEQIDKSGELISLREEVTHLTRSLRRAETETKVLQEALAGQLDSNCQPMATNWIQEKVWLSQEVDKLRVMFLEMKNEKEKLMIKFQSHRNILEENLRRSDKELEKLDDIVQHIYKTLLSIPEVVRGCKELQGLLEFLS Predict reactive species\nFull Name: sperm associated antigen 5\nCalculated Molecular Weight: 134 kDa\nObserved Molecular Weight: 135 kDa, 150 kDa\nGenBank Accession Number: BC000322\nGene Symbol: SPAG5\nGene ID (NCBI): 10615\nRRID: AB_2194787\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96R06\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868892057769,"sku":"14726-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14726-1-ap","provider":"Iright","version":"1.0","type":"link"}