{"product_id":"proteintech-14753-1-ap","title":"Proteintech, 14753-1-AP, SEC11A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SEC11A (14753-1-AP) by Proteintech is a Polyclonal antibody targeting SEC11A in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n14753-1-AP targets SEC11A in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, HeLa cells,  human colon tissue\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSEC11A(Signal peptidase complex catalytic subunit SEC11A) is also named as SEC11L1, SPC18, SPCS4A and belongs to the peptidase S26B family. It is a component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum. SEC11A has some isoforms with the molecular mass of 17-21 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6500 Product name: Recombinant human SEC11A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-179 aa of BC000359 Sequence: MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQNGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGFVPYIGIVTILMNDYPKFKYAVLFLLGLFVLVHRE Predict reactive species\nFull Name: SEC11 homolog A (S. cerevisiae)\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 17-21 kDa\nGenBank Accession Number: BC000359\nGene Symbol: SEC11A\nGene ID (NCBI): 23478\nRRID: AB_2186230\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P67812\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869497118889,"sku":"14753-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14753-1-ap","provider":"Iright","version":"1.0","type":"link"}