{"product_id":"proteintech-14808-1-ap","title":"Proteintech, 14808-1-AP, Hikeshi Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Hikeshi (14808-1-AP) by Proteintech is a Polyclonal antibody targeting Hikeshi in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n14808-1-AP targets Hikeshi in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue,  A375 cells,  mouse brain tissue,  PC-3 cells\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human lung tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6530 Product name: Recombinant human C11orf73 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-193 aa of BC001677 Sequence: MFGCLVAGRLVQTAAQQVAEDKFVFDLPDYESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSMAQQTPVGNAAVSSVDSFTQFTQKMLDNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPL Predict reactive species\nFull Name: chromosome 11 open reading frame 73\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC001677\nGene Symbol: Hikeshi\nGene ID (NCBI): 51501\nRRID: AB_10644295\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q53FT3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868999307433,"sku":"14808-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14808-1-ap","provider":"Iright","version":"1.0","type":"link"}