{"product_id":"proteintech-14811-1-ap","title":"Proteintech, 14811-1-AP, DEXI Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DEXI (14811-1-AP) by Proteintech is a Polyclonal antibody targeting DEXI in IHC, ELISA applications with reactivity to human, mouse, rat samples\n14811-1-AP targets DEXI in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDEXI, also named as MYLE, is a potential marker for glucocorticoid responsiveness in treated patients and may play a role in modulating the function of inflammatory proteins. It is a 95 residues acidic protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6535 Product name: Recombinant human DEXI protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC001083 Sequence: MLGARVAAHLDALGPLVPYVPPPLLPSMFYVGLFFVNVLILYYAFLMEYIVLNVGLVFLPEDMDQALVDLGVLSDPGSGLYDADSELDVFDAYLE Predict reactive species\nFull Name: dexamethasone-induced transcript\nCalculated Molecular Weight: 10 kDa\nGenBank Accession Number: BC001083\nGene Symbol: DEXI\nGene ID (NCBI): 28955\nRRID: AB_2092618\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95424\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887179419817,"sku":"14811-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14811-1-ap","provider":"Iright","version":"1.0","type":"link"}