{"product_id":"proteintech-14858-1-ap","title":"Proteintech, 14858-1-AP, SYK Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SYK (14858-1-AP) by Proteintech is a Polyclonal antibody targeting SYK in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n14858-1-AP targets SYK in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Daudi cells, Raji cells,  Ramos cells\nPositive IHC detected in: human liver cancer tissue, human appendicitis tissue,  human spleen tissue,  human kidney tissue,  human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: Ramos cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSYK belongs to the protein kinase superfamily, Tyr protein kinase family and SYK\/ZAP-70 subfamily. It is positive effector of BCR-stimulated responses. SYK couples the B-cell antigen receptor (BCR) to the mobilization of calcium ion either through a phosphoinositide 3-kinase-dependent pathway, when not phosphorylated on tyrosines of the linker region, or through a phospholipase C-gamma-dependent pathway It phosphorylates USP25 and regulates its intracellular levels. SYK also promotes liver fibrosis by activation of hepatic stellate cells and acts as a biomarker for human hepatocellular carcinoma. (PMID: 29537660) SYK can be detected 66-72 kDa in human and mouse (PMID: 37661351).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6657 Product name: Recombinant human SYK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 368-635 aa of BC001645 Sequence: KLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN Predict reactive species\nFull Name: spleen tyrosine kinase\nCalculated Molecular Weight: 72 kDa\nObserved Molecular Weight: 66-72 kDa\nGenBank Accession Number: BC001645\nGene Symbol: SYK\nGene ID (NCBI): 6850\nENSEMBL Gene ID: ENSG00000165025\nRRID: AB_2878086\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P43405\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868945633449,"sku":"14858-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14858-1-ap","provider":"Iright","version":"1.0","type":"link"}