{"product_id":"proteintech-14869-1-ap","title":"Proteintech, 14869-1-AP, Calcipressin 1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Calcipressin 1 (14869-1-AP) by Proteintech is a Polyclonal antibody targeting Calcipressin 1 in WB, IP, IHC, ELISA applications with reactivity to human,  mouse samples\n14869-1-AP targets Calcipressin 1 in WB, IHC, IP, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, SKOV-3 cells,  human heart tissue,  mouse skeletal muscle tissue,  mouse heart tissue,  A431 cells,  mouse cerebellum tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6457 Product name: Recombinant human RCAN1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-197 aa of BC002864 Sequence: MEEVDLQDLPSATIACHLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQLHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQEKEEEEEMERMRRPKPKIIQTRRPEYTPIHLS Predict reactive species\nFull Name: regulator of calcineurin 1\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 25-29 kDa\nGenBank Accession Number: BC002864\nGene Symbol: RCAN1\nGene ID (NCBI): 1827\nRRID: AB_10640904\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P53805\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869448458409,"sku":"14869-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14869-1-ap","provider":"Iright","version":"1.0","type":"link"}