{"product_id":"proteintech-14872-1-ap","title":"Proteintech, 14872-1-AP, SPCS2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPCS2 (14872-1-AP) by Proteintech is a Polyclonal antibody targeting SPCS2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n14872-1-AP targets SPCS2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, human colon tissue,  mouse stomach tissue,  rat colon tissue,  mouse spleen tissue,  mouse colon tissue,  Jurkat cells\nPositive IP detected in: HeLa cells, mouse colon tissue\nPositive IHC detected in: human skin cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSignal peptidase complex subunit 2 (SPCS2) is multi-pass membrane protein as a component of the microsomal signal peptidase complex, which function to remove signal peptides from nascent proteins before translocation into the endoplasmic reticulum lumen. This protein was evidenced as a 25 kDa protein with function not well known.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6640 Product name: Recombinant human SPCS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-226 aa of BC064957 Sequence: MAAAAVQGGRSGGSGGCSGAGGASNCGTGSGRSGLLDKWKIDDKPVKIDKWDGSAVKNSLDDSVKKVLLEKYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPESKPVLALCVISYFVMMGILTIYTSYKEKSIFLVAHRKDPTGMDPDDIWQLSSSLKRFDDKYTLKLTFISGRTKQQREAEFTKSIAKFFDHSGTLVMDAYEPEISRLHDSLAIERKIK Predict reactive species\nFull Name: signal peptidase complex subunit 2 homolog (S. cerevisiae)\nCalculated Molecular Weight: 25 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC064957\nGene Symbol: SPCS2\nGene ID (NCBI): 9789\nRRID: AB_2255321\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15005\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869604532393,"sku":"14872-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14872-1-ap","provider":"Iright","version":"1.0","type":"link"}