{"product_id":"proteintech-14887-1-ap","title":"Proteintech, 14887-1-AP, GRP75 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GRP75 (14887-1-AP) by Proteintech is a Polyclonal antibody targeting GRP75 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat, zebrafish samples\n14887-1-AP targets GRP75 in WB, IHC, IF\/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, zebrafish samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-29 cells, A549 cells,  mouse testis tissue,  Jurkat cells,  NIH\/3T3 cells,  mouse liver\nPositive IP detected in: mouse brain tissue,  NIH\/3T3 cells\nPositive IHC detected in: human normal colonNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:2000-1:8000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGRP75 (also known as mortalin, HSPA9 or mt-Hsp70) is a constitutively expressed member of the HSPA (HSP70) family of heat-shock proteins. It is located in the mitochondrial matrix and anti-GRP75 is commonly used as the marker for mitochondria. It has been reported that GRP75 is enriched in cancer cells and contributes to carcinogenesis. In addition, decreased expression level of GRP75 has been found in neurodegenerative disorders like Parkinson's disease. This antibody recognized the endogenous GRP75 protein in NIH\/3T3 cells. (PMID: 21640711, 22920904)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, zebrafish\nCited Reactivity: human, mouse, rat, chicken, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6673 Product name: Recombinant human GRP75 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 331-679 aa of BC000478 Sequence: YLTMDSSGPKHLNMKLTRAQFEGIVTDLIRRTIAPCQKAMQDAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ Predict reactive species\nFull Name: heat shock 70kDa protein 9 (mortalin)\nCalculated Molecular Weight: 74 kDa\nObserved Molecular Weight: 70-75 kDa\nGenBank Accession Number: BC000478\nGene Symbol: GRP75\nGene ID (NCBI): 3313\nRRID: AB_2120458\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P38646\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868840120489,"sku":"14887-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14887-1-ap","provider":"Iright","version":"1.0","type":"link"}