{"product_id":"proteintech-14908-1-ap","title":"Proteintech, 14908-1-AP, QDPR Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe QDPR (14908-1-AP) by Proteintech is a Polyclonal antibody targeting QDPR in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n14908-1-AP targets QDPR in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue,  human liver tissue\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDihydropteridine reductase (QDPR), also named as DHPR and HDHPR, is an essential enzyme in the hydroxylating system of the aromatic amino acids, since it catalyses the regeneration of tetrahydrobiopterin (BH4), the natural cofactor of phenylalanine, tyrosine, and tryptophan hydroxylases, from the quininoid-dihydrobiopterin produced in these coupled reactions(PMID:8326489). The QDPR protein is active as a dimer, with a subunit Mr of 26 kDa(PMID:7627180). This protein belongs to the short-chain dehydrogenases\/reductases (SDR) family. Defects in QDPR are the cause of BH4-deficient hyperphenylalaninemia type C (HPABH4C)(PMID:11153907).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6705 Product name: Recombinant human QDPR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-244 aa of BC000576 Sequence: MAAAAAAGEARRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSFTEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKNRPSSGSLIQVVTTEGRTELTPAYF Predict reactive species\nFull Name: quinoid dihydropteridine reductase\nCalculated Molecular Weight: 26 kDa\nObserved Molecular Weight: 28-30 kDa\nGenBank Accession Number: BC000576\nGene Symbol: QDPR\nGene ID (NCBI): 5860\nRRID: AB_2173013\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P09417\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869008056489,"sku":"14908-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14908-1-ap","provider":"Iright","version":"1.0","type":"link"}