{"product_id":"proteintech-14912-1-ap","title":"Proteintech, 14912-1-AP, NDUFB7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NDUFB7 (14912-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFB7 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n14912-1-AP targets NDUFB7 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse ovary tissue,  MCF-7 cells,  mouse brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human brain tissue,  human cervical cancer tissue,  human heart tissue,  human kidney tissue,  human liver tissue,  human lung tissue,  human placenta tissue,  human spleen tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNDUFB7(NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7) is also named as CI-B18 and belongs to the complex I NDUFB7 subunit family. It is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which couples the oxidation of NADH to the reduction of ubiquinone and the translocation of protons across the inner membrane. NDUFB7 protein lacks a mitochondrial targeting signal and transmembrane domains. However, it has a Cx(9)C motif that includes an intermembrane space targeting signal.(PMID:21310150).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6709 Product name: Recombinant human NDUFB7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-137 aa of BC002595 Sequence: MGAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL Predict reactive species\nFull Name: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa\nCalculated Molecular Weight: 16 kDa\nObserved Molecular Weight: 18-22 kDa\nGenBank Accession Number: BC002595\nGene Symbol: NDUFB7\nGene ID (NCBI): 4713\nRRID: AB_2235903\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P17568\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868919681193,"sku":"14912-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14912-1-ap","provider":"Iright","version":"1.0","type":"link"}