{"product_id":"proteintech-14922-1-ap","title":"Proteintech, 14922-1-AP, ICOSLG\/B7-H2\/CD275 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ICOSLG\/B7-H2\/CD275 (14922-1-AP) by Proteintech is a Polyclonal antibody targeting ICOSLG\/B7-H2\/CD275 in WB, IHC, ELISA applications with reactivity to human samples\n14922-1-AP targets ICOSLG\/B7-H2\/CD275 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Daudi cells, JAR cells\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nICOSLG, also known as B7H2 or GL50, is a type I transmembrane glycoprotein belonging to the B7 ligand family. ICOSLG is extensively expressed on professional antigen-presenting cells including B cells, macrophages, and dendritic cells, as well as non-lymphoid cells including mesenchymal stem cells, endothelial cells, fibroblasts, and tumor cells (PMID: 33756276; 35800767). It is a specific ligand for the T-cell-specific cell surface receptor ICOS and acts as a co-stimulatory molecule (PMID: 11023515; 11007762). The interaction of ICOSLG and ICOS plays important roles in the activation, proliferation, differentiation, and cytokine production of T cells as well as in the antibody secretion from B cells during secondary immune responses (PMID: 21851236).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6392 Product name: Recombinant human ICOSLG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-302 aa of BC064637 Sequence: MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV Predict reactive species\nFull Name: inducible T-cell co-stimulator ligand\nCalculated Molecular Weight: 33 kDa, 34 kDa\nObserved Molecular Weight: 60-70 kDa\nGenBank Accession Number: BC064637\nGene Symbol: ICOSLG\nGene ID (NCBI): 23308\nRRID: AB_2122732\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75144\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869466153129,"sku":"14922-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14922-1-ap","provider":"Iright","version":"1.0","type":"link"}