{"product_id":"proteintech-14929-1-ap","title":"Proteintech, 14929-1-AP, POFUT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nPOFUT1 Polyclonal Antibody for WB, IHC, IF\/ICC, IP, ELISA\n14929-1-AP targets POFUT1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HCT 116 cells, HUVEC cells\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human liver cancer tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HUVEC cells, A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPOFUT1 (protein O-fucosyltransferase 1), also known as GDP-fucose protein O-fucosyltransferase, is an enzyme that catalyzes the reaction that attaches fucose through an O-glycosidic linkage to a conserved serine or threonine residue in EGF domains and plays a crucial role in Notch signaling.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6710 Product name: Recombinant human POFUT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-182 aa of BC000582 Sequence: MGAAAWARPLSVSFLLLLLPLPGMPAGSWDPAGYLLYCPCMGRFGNQADHFLGSLAFAKLLNRTLAVPPWIEYQHHKPPFTNLHVSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGPFWDQFHVSFNKSELFTGISFSASYREQWSQRR Predict reactive species\nFull Name: protein O-fucosyltransferase 1\nCalculated Molecular Weight: 44 kDa\nObserved Molecular Weight: 40-45 kDa\nGenBank Accession Number: BC000582\nGene Symbol: POFUT1\nGene ID (NCBI): 23509\nRRID: AB_2166123\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H488\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868903395497,"sku":"14929-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14929-1-ap","provider":"Iright","version":"1.0","type":"link"}