{"product_id":"proteintech-14930-1-ap","title":"Proteintech, 14930-1-AP, GCDH Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GCDH (14930-1-AP) by Proteintech is a Polyclonal antibody targeting GCDH in WB, IHC, ELISA applications with reactivity to human samples\n14930-1-AP targets GCDH in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, SH-SY5Y cells\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGCDH is a nuclear-encoded mitochondrial protein involved in the catabolic pathway of tryptophan, lysine and hydroxylysine. The functional enzyme is a homotetramer of 43.3 kDa subunits that resides in the mitochondrial matrix. GCDH activity reduction leads to predominant accumulation of glutaric (GA) and 3- hydroxyglutaric (3HGA) acids in tissues, mostly brain, and biological fluids of affected patients. GCDH is widely expressed and has the highest levels in liver and kidney, which is consistent with its role in amino acid oxidation. (PMID: 27984186, 33001399)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6713 Product name: Recombinant human GCDH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 85-438 aa of BC002579 Sequence: LANRNEVFHREIISEMGELGVLGPTIKGYGCAGVSSVAYGLLARELERVDSGYRSAMSVQSSLVMHPIYAYGSEEQRQKYLPQLAKGELLGCFGLTEPNSGSDPSSMETRAHYNSSNKSYTLNGTKTWITNSPMADLFVVWARCEDGCIRGFLLEKGMRGLSAPRIQGKFSLRASATGMIIMDGVEVPEENVLPGASSLGGPFGCLNNARYGIAWGVLGASEFCLHTARQYALDRMQFGVPLARNQLIQKKLADMLTEITLGLHACLQLGRLKDQDKAAPEMVSLLKRNNCGKALDIARQARDMLGGNGISDEYHVIRHAMNLEAVNTYEGTHDIHALILGRAITGIQAFTASK Predict reactive species\nFull Name: glutaryl-Coenzyme A dehydrogenase\nCalculated Molecular Weight: 48 kDa\nObserved Molecular Weight: 44-48 kDa\nGenBank Accession Number: BC002579\nGene Symbol: GCDH\nGene ID (NCBI): 2639\nRRID: AB_2878092\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92947\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869407695017,"sku":"14930-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14930-1-ap","provider":"Iright","version":"1.0","type":"link"}