{"product_id":"proteintech-14931-1-ap","title":"Proteintech, 14931-1-AP, GNPAT Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GNPAT (14931-1-AP) by Proteintech is a Polyclonal antibody targeting GNPAT in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n14931-1-AP targets GNPAT in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, human placenta tissue,  Transfected HEK-293 cells,  COLO 320 cells,  HeLa cells,  PC-3 cells,  mouse brain tissue\nPositive IP detected in: COLO 320 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGNPAT, also named as DAPAT and DHAPAT, belongs to the GPAT\/DAPAT family. It is a key enzyme in the biosynthesis of ether phospholipids. GNPAT is localized exclusively within peroxisomes. Full GNPAT activity depends not only on the presence of AGPS, but also on the integrity of substrate channeling from GNPAT to AGPS. (PMID:21990100) This antibody recognize the 69 kDa GNPAT protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, hamster\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6735 Product name: Recombinant human GNPAT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 331-680 aa of BC000450 Sequence: PVSLRSLAAGRMSRSSYNLVPRYIPQKQSEDMHAFVTEVAYKMELLQIENMVLSPWTLIVAVLLQNRPSMDFDALVEKTLWLKGLTQAFGGFLIWPDNKPAEEVVPASILLHSNIASLVKDQVILKVDSGDSEVVDGLMLQHITLLMCSAYRNQLLNIFVRPSLVAVALQMTPGFRKEDVYSCFRFLRDVFADEFIFLPGNTLKDFEEGCYLLCKSEAIQVTTKDILVTEKGNTVLEFLVGLFKPFVESYQIICKHLLSEEEDHFSEEQYLAAVRKFTSQLLDQGTSQCYDVLSSDVQKNALAACVRLGVVEKKKINNNCIFNVNEPATTKLEEMLGCKTPIGKPATAKL Predict reactive species\nFull Name: glyceronephosphate O-acyltransferase\nCalculated Molecular Weight: 77 kDa\nObserved Molecular Weight: 65-69 kDa\nGenBank Accession Number: BC000450\nGene Symbol: GNPAT\nGene ID (NCBI): 8443\nRRID: AB_2110546\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15228\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868912308393,"sku":"14931-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14931-1-ap","provider":"Iright","version":"1.0","type":"link"}