{"product_id":"proteintech-14985-1-ap","title":"Proteintech, 14985-1-AP, PPA1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PPA1 (14985-1-AP) by Proteintech is a Polyclonal antibody targeting PPA1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n14985-1-AP targets PPA1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human heart tissue,  human liver tissue\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human breast cancer tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPPA1(Inorganic pyrophosphatase) is also named as IOPPP, PP and PPase. It maintains the thermodynamic favorability of these reactions by catalyzing the hydrolysis of pyrophosphates into organic phosphates, which are then exported across the cell membrane(PMID:16300924).The erythrocyte inorganic pyrophosphatase molecule would appear to be a dimer(PMID:4130389).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6969 Product name: Recombinant human PPA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-289 aa of BC001022 Sequence: MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIGSKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKPGYLEATVDWFRRYKVPDGKPENEFAFNAEFKDKDFAIDIIKSTHDHWKALVTKKTNGKGISCMNTTLSESPFKCDPDAARAIVDALPPPCESACTVPTDVDKWFHHQKN Predict reactive species\nFull Name: pyrophosphatase (inorganic) 1\nCalculated Molecular Weight: 33 kDa\nObserved Molecular Weight: 33 kDa\nGenBank Accession Number: BC001022\nGene Symbol: PPA1\nGene ID (NCBI): 5464\nRRID: AB_2167890\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15181\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869488894121,"sku":"14985-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14985-1-ap","provider":"Iright","version":"1.0","type":"link"}