{"product_id":"proteintech-15015-1-ap","title":"Proteintech, 15015-1-AP, CNIH4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CNIH4 (15015-1-AP) by Proteintech is a Polyclonal antibody targeting CNIH4 in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n15015-1-AP targets CNIH4 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, rat testis tissue\nPositive IF-P detected in: mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCNIH4 (Cornichon Family Member 4) is a protein-coding gene belonging to the cornichon family, which plays a critical role in regulating G protein-coupled receptor (GPCR) trafficking from the endoplasmic reticulum to the cell surface. It facilitates GPCR export through the early secretory pathway and is regulated by TMED9.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6965 Product name: Recombinant human CNIH4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC000573 Sequence: MEAVVFVFSLLDCCALIFLSVYFIITLSDLECDYINARSCCSKLNKWVIPELIGHTIVTVLLLMSLHWFIFLLNLPVATWNIYRYIMVPSGNMGVFDPTEIHNRGQLKSHMKEAMIKLG Predict reactive species\nFull Name: cornichon homolog 4 (Drosophila)\nCalculated Molecular Weight: 16 kDa\nObserved Molecular Weight: 16-18 kDa\nGenBank Accession Number: BC000573\nGene Symbol: CNIH4\nGene ID (NCBI): 29097\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9P003\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869525692585,"sku":"15015-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15015-1-ap","provider":"Iright","version":"1.0","type":"link"}