{"product_id":"proteintech-15023-1-ap","title":"Proteintech, 15023-1-AP, CPSF4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CPSF4 (15023-1-AP) by Proteintech is a Polyclonal antibody targeting CPSF4 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n15023-1-AP targets CPSF4 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HepG2 cells,  HeLa cells,  HEK-293 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human endometrial cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe mature 3-prime ends of cellular mRNAs are producted by endonucleolytic cleavage of the primary transcripts, followed by polyadenylation of the upstream cleavage products. The cleavage and polyadenylation specificity factor (CPSF) has a essential role in pre-mRNA 3-prime end processing in that it is required in both the cleavage step and subsequent poly(A) addition [PMID: 9651582]. CPSF4 is a component of the cleavage and polyadenylation specificity factor (CPSF) complex, whose other components are CPSF1, CPSF2, CPSF3 and FIP1L1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7103 Product name: Recombinant human CPSF4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-244 aa of BC003101 Sequence: MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPPLPQQTQPPAKQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAFLSGQ Predict reactive species\nFull Name: cleavage and polyadenylation specific factor 4, 30kDa\nCalculated Molecular Weight: 30 kDa\nObserved Molecular Weight: 27-30 kDa\nGenBank Accession Number: BC003101\nGene Symbol: CPSF4\nGene ID (NCBI): 10898\nRRID: AB_2084544\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95639\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868901331113,"sku":"15023-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15023-1-ap","provider":"Iright","version":"1.0","type":"link"}