{"product_id":"proteintech-15043-1-ap","title":"Proteintech, 15043-1-AP, AP1S2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AP1S2 (15043-1-AP) by Proteintech is a Polyclonal antibody targeting AP1S2 in WB, ELISA applications with reactivity to human, rat samples\n15043-1-AP targets AP1S2 in WB, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat epididymis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAP1S2 is a subunit of the adaptor complex AP-1. It belongs to the adaptor complexes small subunit family. Adaptor protein (AP) complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP-1 is found at the cytoplasmic face of coated vesicles located at the Golgi complex, where it mediates both the recruitment of clathrin to the membrane and the recognition of sorting signals within the cytosolic tails of transmembrane receptors.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6911 Product name: Recombinant human AP1S2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-157 aa of BC001117 Sequence: MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQEEAETPRSVLEEIGLT Predict reactive species\nFull Name: adaptor-related protein complex 1, sigma 2 subunit\nCalculated Molecular Weight: 19 kDa\nObserved Molecular Weight: 19-24 kDa\nGenBank Accession Number: BC001117\nGene Symbol: AP1S2\nGene ID (NCBI): 8905\nRRID: AB_3669197\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P56377\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46884971151529,"sku":"15043-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15043-1-ap","provider":"Iright","version":"1.0","type":"link"}