{"product_id":"proteintech-15061-1-ap","title":"Proteintech, 15061-1-AP, DHRS7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DHRS7 (15061-1-AP) by Proteintech is a Polyclonal antibody targeting DHRS7 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n15061-1-AP targets DHRS7 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells\nPositive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDHRS7 (Dehydrogenase\/Reductase (SDR family) member 7), also known as SDR34C1, retSDR4, is a member of a large family of short-chain dehydrogenases\/reductases (SDR). The DHRS7 gene codes for two subtypes and is found on chromosome 14. Isotype 1 (38 kDa) has 339 amino acids, while isotype 2 (32 kDa) contains 289 amino acids (PMID: 26466768). DHRS7 has been demonstrated to be an integral protein facing the lumen of the endoplasmic reticulum with lack of posttranscriptional glycosylation modification(PMID: 24246760).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7064 Product name: Recombinant human DHRS7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-183 aa of BC000637 Sequence: RADGDLTLLWAEWQGRRPEWELTDMVVWVTGASSGIGEELAYQLSKLGVSLVLSARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEAATKAVLQEFGRIDILVNNGGMSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMIERKQG Predict reactive species\nFull Name: dehydrogenase\/reductase (SDR family) member 7\nCalculated Molecular Weight: 38 kDa\nObserved Molecular Weight: 32-38 kDa\nGenBank Accession Number: BC000637\nGene Symbol: DHRS7\nGene ID (NCBI): 51635\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y394\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887186661545,"sku":"15061-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15061-1-ap","provider":"Iright","version":"1.0","type":"link"}