{"product_id":"proteintech-15062-1-ap","title":"Proteintech, 15062-1-AP, EXOSC3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EXOSC3 (15062-1-AP) by Proteintech is a Polyclonal antibody targeting EXOSC3 in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n15062-1-AP targets EXOSC3 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A2780 cells, HEK-293T cells,  PC-3 cells,  NIH\/3T3 cells,  mouse spleen tissue\nPositive IP detected in: A2780 cells\nPositive IF\/ICC detected in: PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRNA exosomes are multi-subunit complexes conserved throughout evolution, and they are emerging as the major cellular machinery for processing, surveillance and turnover of a diverse spectrum of coding and noncoding RNA substrates essential for viability[PMID:22544365]. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts [PMID:11782436]. EXOSC3 is a non-catalytic component of the RNA exosome complex which has 3'-\u0026gt;5' exoribonuclease activity and involves in a multitude of cellular RNA processing and degradation events. EXOSC3 as peripheral part of the Exo-9 complex stabilizes the hexameric ring of Rnase PH-domain subunits through contacts with EXOSC9 and EXOSC5 [PMID:21255825].\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7065 Product name: Recombinant human EXOSC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-275 aa of BC002437 Sequence: MAEPASVAAESLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERPLSLNARACSRVRVVCGPGLRRCGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES Predict reactive species\nFull Name: exosome component 3\nCalculated Molecular Weight: 30 kDa\nObserved Molecular Weight: 31 kDa\nGenBank Accession Number: BC002437\nGene Symbol: EXOSC3\nGene ID (NCBI): 51010\nRRID: AB_2278183\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NQT5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868901757097,"sku":"15062-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15062-1-ap","provider":"Iright","version":"1.0","type":"link"}