{"product_id":"proteintech-15075-1-ap","title":"Proteintech, 15075-1-AP, SUOX Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SUOX (15075-1-AP) by Proteintech is a Polyclonal antibody targeting SUOX in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n15075-1-AP targets SUOX in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human liver tissue,  L02 cells,  mouse liver tissue\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Hela cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSUOX(sulfite oxidase) catalyzes the oxidation of sulfite to sulfate, the terminal reaction in the oxidative degradation pathway of the sulfur-containing amino acids cysteine and methionine. The enzyme is a dimer of identical subunits and is located in the intermembrane space of mitochondria(PMID:9600976). Defects in SUOX are the cause of isolated sulfite oxidase deficiency (ISOD).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7146 Product name: Recombinant human SUOX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 182-545 aa of BC065193 Sequence: RHPALKVNSQRPFNAEPPPELLTENYITPNPIFFTRNHLPVPNLDPDTYRLHVVGAPGGQSLSLSLDDLHNFPRYEITVTLQCAGNRRSEMTQVKEVKGLEWRTGAISTARWAGARLCDVLAQAGHQLCETEAHVCFEGLDSDPTGTAYGASIPLARAMDPEAEVLLAYEMNGQPLPRDHGFPVRVVVPGVVGARHVKWLGRVSVQPEESYSHWQRRDYKGFSPSVDWETVDFDSAPSIQELPVQSAITEPRDGETVESGEVTIKGYAWSGGGRAVIRVDVSLDGGLTWQVAKLDGEEQRPRKAWAWRLWQLKAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLRGVLSNAWHRVHVYVSP Predict reactive species\nFull Name: sulfite oxidase\nCalculated Molecular Weight: 60 kDa\nObserved Molecular Weight: 52 kDa, 60 kDa\nGenBank Accession Number: BC065193\nGene Symbol: SUOX\nGene ID (NCBI): 6821\nRRID: AB_2198558\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P51687\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869386559657,"sku":"15075-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15075-1-ap","provider":"Iright","version":"1.0","type":"link"}