{"product_id":"proteintech-15128-1-ap","title":"Proteintech, 15128-1-AP, NHP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NHP2 (15128-1-AP) by Proteintech is a Polyclonal antibody targeting NHP2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n15128-1-AP targets NHP2 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells, Caco-2 cells,  HeLa cells\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNHP2 belongs to the H\/ACA small nucleolar ribonucleoprotein (H\/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA. It is required for ribosome biogenesis and telomere maintenance, and for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, yeast\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7251 Product name: Recombinant human NHP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-153 aa of BC000009 Sequence: MTKIKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPTCVIMVKPHEEYQEAYDECLEEVQSLPLPL Predict reactive species\nFull Name: NHP2 ribonucleoprotein homolog (yeast)\nCalculated Molecular Weight: 17 kDa\nObserved Molecular Weight: 17-20 kDa\nGenBank Accession Number: BC000009\nGene Symbol: NHP2\nGene ID (NCBI): 55651\nRRID: AB_2267290\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NX24\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868879802537,"sku":"15128-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15128-1-ap","provider":"Iright","version":"1.0","type":"link"}