{"product_id":"proteintech-15131-1-ap","title":"Proteintech, 15131-1-AP, ATG4B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATG4B (15131-1-AP) by Proteintech is a Polyclonal antibody targeting ATG4B in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n15131-1-AP targets ATG4B in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HuH-7 cells,  HepG2 cells,  Jurkat cells,  HeLa cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human pancreas cancer tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATG4B(autophagy 4) is also named as APG4B, AUTL1, KIAA0943 and belongs to the peptidase C54 family. It is a homolog of yeast Apg4, a cysteine protease involved in autophagy and is a cytoplasmic enzyme. This protein is highly expressed in skeletal muscle, with lower expression in heart, liver, and pancreas and no expression is detected in fetal tissues by the northern blot. ATG4B is widely expressed in tumor cell lines (PMID:12446702). It has some isoforms produced by alternative splicing with molecular mass of 31-52 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7261 Product name: Recombinant human ATG4B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-393 aa of BC000719 Sequence: MDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRKNFPAIGGTGPTSDTGWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDSYYSIHQIAQMGVGEGKSIGQWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRTSVPCAGATAFPADSDRHCNGFPAGAEVTNRPSPWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEPTDGCFIPDESFHCQHPPCRMSIAELDPSIAVGFFCKTEDDFNDWCQQVKKLSLLGGALPMFELVEQQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEILSL Predict reactive species\nFull Name: ATG4 autophagy related 4 homolog B (S. cerevisiae)\nCalculated Molecular Weight: 44 kDa\nObserved Molecular Weight: 44 kDa\nGenBank Accession Number: BC000719\nGene Symbol: ATG4B\nGene ID (NCBI): 23192\nRRID: AB_2064405\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y4P1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868858634409,"sku":"15131-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15131-1-ap","provider":"Iright","version":"1.0","type":"link"}