{"product_id":"proteintech-15133-1-ap","title":"Proteintech, 15133-1-AP, ADI1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ADI1 (15133-1-AP) by Proteintech is a Polyclonal antibody targeting ADI1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15133-1-AP targets ADI1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human testis tissue,  rat colon tissue\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nADI1(acireductone dioxygenase 1 ) is also named as SIPL, ARD, APL1, HMFT1638, MTCBP-1, FLJ10913, MTCBP1 and belongs to the acireductone dioxygenase (ARD) family. It catalyzes the formation of formate and 2-keto-4-methylthiobutyrate (KMTB) from 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene).The downregulation of ADI1 protein expression in human prostate cancer specimens argues that ADI1 potentially inhibits the growth that occurs during prostate cancer progression(PMID:17786183). It has 2 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7274 Product name: Recombinant human ADI1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-179 aa of BC001467 Sequence: MVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNYSWMDIITICKDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEKNYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTA Predict reactive species\nFull Name: acireductone dioxygenase 1\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC001467\nGene Symbol: ADI1\nGene ID (NCBI): 55256\nRRID: AB_2305014\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BV57\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869442986153,"sku":"15133-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15133-1-ap","provider":"Iright","version":"1.0","type":"link"}