{"product_id":"proteintech-15140-1-ap","title":"Proteintech, 15140-1-AP, GLO1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GLO1 (15140-1-AP) by Proteintech is a Polyclonal antibody targeting GLO1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n15140-1-AP targets GLO1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells, HEK-293 cells,  HeLa cells,  rat liver tissue,  HepG2 cells,  mouse liver tissue\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human thyroid cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGlo1 is known to play a role in many diseases including diabetes mellitus, Alzheimer's disease, and cancer. The molecular mass of the dimer was 46 kDa determined by gel permeation chromatography.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7314 Product name: Recombinant human GLO1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-184 aa of BC001741 Sequence: MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLM Predict reactive species\nFull Name: glyoxalase I\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 21-25 kDa\nGenBank Accession Number: BC001741\nGene Symbol: GLO1\nGene ID (NCBI): 2739\nRRID: AB_2109890\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q04760\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868902150313,"sku":"15140-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15140-1-ap","provider":"Iright","version":"1.0","type":"link"}