{"product_id":"proteintech-15156-1-ap","title":"Proteintech, 15156-1-AP, SFXN3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SFXN3 (15156-1-AP) by Proteintech is a Polyclonal antibody targeting SFXN3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n15156-1-AP targets SFXN3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: C6 cells, Neuro-2a cells,  rat brain tissue,  NIH\/3T3 cells,  HeLa cells,  mouse brain tissue,  SH-SY5Y cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: BxPC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSFXN3, a mitochondrial membrane protein, is a member of sideroflexin family. Serum anti-SFXN3 autoantibody was elevated in early stage of the oral squamous cell carcinoma significantly, indicating its clinical value for diagnosis of oral squamous cell carcinoma.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7203 Product name: Recombinant human SFXN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-144 aa of BC000124 Sequence: MESKMGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGAQLEASRNIVQNYRAGVVTPGITEDQLWRAKYVYDSAFHPDTGEKVVLIGRMSAQVPMNMTITGCMLTFYRKTPTVVFWQWVNQSFNAIVNYSNRSGDTP Predict reactive species\nFull Name: sideroflexin 3\nCalculated Molecular Weight: 36 kDa\nObserved Molecular Weight: 36 kDa\nGenBank Accession Number: BC000124\nGene Symbol: SFXN3\nGene ID (NCBI): 81855\nRRID: AB_2185825\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BWM7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869429846185,"sku":"15156-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15156-1-ap","provider":"Iright","version":"1.0","type":"link"}