{"product_id":"proteintech-15192-1-ap","title":"Proteintech, 15192-1-AP, ATP1B1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATP1B1 (15192-1-AP) by Proteintech is a Polyclonal antibody targeting ATP1B1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n15192-1-AP targets ATP1B1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, human heart tissue,  human brain tissue,  mouse heart tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human brain tissue,  human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATP1B1 is one of beta subunits of the Na+\/K+ ATPase and responsible for formation and structural integrity of the Na+\/K+ ATPase. The Na+\/K+ ATPase is a plasma membrane pump consisting of alpha, beta, and gamma subunits. At least four of Na+\/K+-ATPase beta subunits (β1, β2, β3, β4) have been identified in mammalian cells; the β1-subunit (ATP1B1) is the most ubiquitous. The Na+\/K+ ATPase β subunits have multiple N-glycosylation sites. The predicted MW of ATP1B1 is 35 kDa, while it migrates around 40-52 kDa due to the variable glycosylation. (PMID: 10896885, 17714085)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7279 Product name: Recombinant human ATP1B1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 59-303 aa of BC000006 Sequence: LTISEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS Predict reactive species\nFull Name: ATPase, Na+\/K+ transporting, beta 1 polypeptide\nCalculated Molecular Weight: 35 kDa\nObserved Molecular Weight: 45-52 kDa\nGenBank Accession Number: BC000006\nGene Symbol: ATP1B1\nGene ID (NCBI): 481\nRRID: AB_2290040\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P05026\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868905197737,"sku":"15192-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15192-1-ap","provider":"Iright","version":"1.0","type":"link"}