{"product_id":"proteintech-15211-1-ap","title":"Proteintech, 15211-1-AP, FAIM2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAIM2 (15211-1-AP) by Proteintech is a Polyclonal antibody targeting FAIM2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n15211-1-AP targets FAIM2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFas apoptotic inhibitory molecule 2 (FAIM2), also known as NMP35, TMBIM2 or Protein lifeguard (LFG), is a Fas antagonist highly expressed in the nervous system. FAIM2 is an intrinsic neuroprotective factor activated by stress in photoreceptors and delays FAS-mediated photoreceptor apoptosis (PMID: 28708137). FAIM2 is a potential pan-cancer biomarker for prognosis and immune infiltration (PMID: 36185230).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7366 Product name: Recombinant human FAIM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-104 aa of BC000051 Sequence: MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVDPSSSSSYDNGFPTGDHELFTTFSWDDQKVRRVFVR Predict reactive species\nFull Name: Fas apoptotic inhibitory molecule 2\nCalculated Molecular Weight: 35 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC000051\nGene Symbol: FAIM2\nGene ID (NCBI): 23017\nRRID: AB_3085452\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BWQ8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887629815977,"sku":"15211-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15211-1-ap","provider":"Iright","version":"1.0","type":"link"}