{"product_id":"proteintech-15220-1-ap","title":"Proteintech, 15220-1-AP, RPAIN Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RPAIN (15220-1-AP) by Proteintech is a Polyclonal antibody targeting RPAIN in WB, IP, IHC, ELISA applications with reactivity to human,   mouse samples\n15220-1-AP targets RPAIN in WB, IP, IHC, ELISA applications and shows reactivity with human,   mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells, mouse ovary tissue,  A2780 cells\nPositive IP detected in: A375 cells\nPositive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPAIN, also named as RIP, mediates the import of RPA complex into the nucleus, possibly via some interaction with importin beta. RPAIN has many isoforms with MW 25-27 kDa, 12 kDa and 16-19 kDa. The publication with PMID: 16135809 reported the MW 30 and 45 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7392 Product name: Recombinant human RPAIN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-145 aa of BC004451 Sequence: MAESLRSPRRSLYKLVGSPPWKEAFRQRCLERMRNSRDRLLNRYRQAGSSGPGNSQNSFLVQEVMEEEWNALQSVENCPEDLAQLEELIDMAVLEEIQQELINQEQSIISEYEKSLQFDEKCLSIMLAEWEANPLICPVCTNLLS Predict reactive species\nFull Name: RPA interacting protein\nCalculated Molecular Weight: 25 kDa\nObserved Molecular Weight: 30-45 kDa\nGenBank Accession Number: BC004451\nGene Symbol: RPAIN\nGene ID (NCBI): 84268\nRRID: AB_2180976\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86UA6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887787724969,"sku":"15220-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15220-1-ap","provider":"Iright","version":"1.0","type":"link"}