{"product_id":"proteintech-15257-1-ap","title":"Proteintech, 15257-1-AP, Elastin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Elastin (15257-1-AP) by Proteintech is a Polyclonal antibody targeting Elastin in WB, IHC, IP, ELISA applications with reactivity to human samples\n15257-1-AP targets Elastin in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human artery tissue\nPositive IP detected in: human placenta tissue\nPositive IHC detected in: human lung tissue, human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nElastic fibers are an abundant and integral part of many extracellular matrices, in which they provide the elastic properties to tissues such as arterial, lung, and skin. Elastic fibers are consisting of an elastin core surrounded by a mantle of fibrillin-rich microfibrils (PMID: 12082143). Elastin is an extremely durable, insoluble biopolymer formed through the lysine-mediated crosslinking of its soluble precursor tropoelastin, which is an approximately 60-70 kDa protein (PMID: 15837523). Deletions and mutations in the elastin gene (ELN) are associated with supravalvular aortic stenosis (SVAS) and autosomal dominant cutis laxa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7179 Product name: Recombinant human ELN protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 307-658 aa of BC065566 Sequence: GLVPGGPGFGPGVVGVPGAGVPGVGVPGAGIPVVPGAGIPGAAVPGVVSPEAAAKAAAKAAKYGARPGVGVGGIPTYGVGAGGFPGFGVGVGGIPGVAGVPSVGGVPGVGGVPGVGISPEAQAAAAAKAAKYGLVPGVGVAPGVGVAPGVGVAPGVGLAPGVGVAPGVGVAPGVGVAPGIGPGGVAGAAAGLGAGIPGLGVGVGVPGLGVGAGVPGLGVGAGVPGFRAVPGALAAAKAAKYGAAVPGVLGGLGALGGVGIPGGVVGAGPAAAAAAAKAAAKAAQFGLVGAAGLGGLGVGGLGVPGVGGLGGIPPAAAAKAAKYGVAARPGFGLSPIFPGGACLGKACGRKRK Predict reactive species\nFull Name: elastin\nCalculated Molecular Weight: 68 kDa\nObserved Molecular Weight: 60-70 kDa\nGenBank Accession Number: BC065566\nGene Symbol: Elastin\nGene ID (NCBI): 2006\nRRID: AB_2878120\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P15502\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868864499881,"sku":"15257-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15257-1-ap","provider":"Iright","version":"1.0","type":"link"}