{"product_id":"proteintech-15274-1-ap","title":"Proteintech, 15274-1-AP, SPARC Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPARC (15274-1-AP) by Proteintech is a Polyclonal antibody targeting SPARC in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig samples\n15274-1-AP targets SPARC in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells, human testis tissue,  ROS1728 cells,  human placenta tissue\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSecreted Protein Acidic And Cysteine Rich (SPARC), also known as osteonectin or basement-membrane protein 40 (BM-40), is a secreted protein essential in the calcification of bone.What is the molecular weight of SPARC?The calculated molecular mass of SPARC is 35 kDa. SPARC is a glycoprotein consisting of 303 amino acids in the cytoplasm and 286 amino acids after the signal sequence is cleaved in secretion.Where is SPARC expressed?Osteoblasts secrete SPARC during bone formation, with high levels found in immature bone compared to mature bone that is in homeostasis (PMID: 2440898). SPARC is also secreted in adult mineralized tissues that have high turnover, such as osteoid and dentin, by cells other than osteoblasts. This includes bone marrow progenitor cells and hypertrophic chondrocytes but also endothelial cells and fibroblasts.Though previously described as being exclusively expressed in mineralized tissue, it is now understood that SPARC is more widely expressed and is associated with high levels of collagen deposition, found in the extracellular matrix (ECM) of a number of tissues.What is the function of SPARC?SPARC contains both a collagen-binding domain and a hydroxyapatite (HA) binding region, so is thought to enhance mineralization by binding both collagen and HA crystals, causing the release of calcium ions (PMID: 26851678).SPARC can bind to a number of different ECM proteins, particularly collagen, and may even influence the assembly of these proteins (PMID: 19798598). It is known to regulate interactions between cells and the ECM, meaning it plays a role in many important processes such as cell migration and proliferation.What diseases are associated with SPARC?Overexpression of SPARC has been identified in a number of different types of cancers (PMID: 18849185), although its role may vary. For example, in neuroblastomas SPARC acts as a suppressor but in gliomas, it causes greater invasion of the tumor. Mutations in SPARC can also lead to Osteogenesis Imperfecta, also known as brittle bone disease (PMID: 26027498).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human, mouse, rat, deer, sika deer\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7390 Product name: Recombinant human SPARC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-303 aa of BC004974 Sequence: MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI Predict reactive species\nFull Name: secreted protein, acidic, cysteine-rich (osteonectin)\nCalculated Molecular Weight: 35 kDa\nObserved Molecular Weight: 35-43 kDa\nGenBank Accession Number: BC004974\nGene Symbol: SPARC\nGene ID (NCBI): 6678\nRRID: AB_2194961\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P09486\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887965196457,"sku":"15274-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15274-1-ap","provider":"Iright","version":"1.0","type":"link"}