{"product_id":"proteintech-15278-1-ap","title":"Proteintech, 15278-1-AP, POLE3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe POLE3 (15278-1-AP) by Proteintech is a Polyclonal antibody targeting POLE3 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n15278-1-AP targets POLE3 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells,  HepG2 cells\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7396 Product name: Recombinant human POLE3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-147 aa of BC003166 Sequence: MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQDKSRDEDNDEDEERLEEEEQNEEEEVDN Predict reactive species\nFull Name: polymerase (DNA directed), epsilon 3 (p17 subunit)\nCalculated Molecular Weight: 17 kDa\nObserved Molecular Weight: 17 kDa\nGenBank Accession Number: BC003166\nGene Symbol: POLE3\nGene ID (NCBI): 54107\nRRID: AB_2166751\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NRF9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869574975657,"sku":"15278-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15278-1-ap","provider":"Iright","version":"1.0","type":"link"}