{"product_id":"proteintech-15279-1-ap","title":"Proteintech, 15279-1-AP, DHRS4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DHRS4 (15279-1-AP) by Proteintech is a Polyclonal antibody targeting DHRS4 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15279-1-AP targets DHRS4 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat liver tissue, mouse liver tissue,  HeLa cells,  HepG2 cells\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human cervical cancer tissue, human cervix tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDHRS4(Dehydrogenase\/reductase SDR family member 4) is also named as PHCR , NRDR ,PSCD , SCAD-SRL, and belongs to the short-chain dehydrogenases\/reductases (SDR) family. It can also catalyze the oxidation of all-trans-retinol with NADP as co-factor, but with much lower efficiency. Human DHRS4 is a tetramer composed of 27 kDa subunits, which is inactivated at low temperature without dissociation into subunits(PMID:18571493).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7398 Product name: Recombinant human DHRS4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-278 aa of BC003019 Sequence: MHKAGLLGLCARAWNSVRMASSGMTRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGGTPSRL Predict reactive species\nFull Name: dehydrogenase\/reductase (SDR family) member 4\nCalculated Molecular Weight: 30 kDa\nObserved Molecular Weight: 29 kDa\nGenBank Accession Number: BC003019\nGene Symbol: DHRS4\nGene ID (NCBI): 10901\nRRID: AB_2292856\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BTZ2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869673967785,"sku":"15279-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15279-1-ap","provider":"Iright","version":"1.0","type":"link"}