{"product_id":"proteintech-15285-1-ap","title":"Proteintech, 15285-1-AP, URM1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe URM1 (15285-1-AP) by Proteintech is a Polyclonal antibody targeting URM1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n15285-1-AP targets URM1 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HepG2 cells,  mouse liver tissue,  human placenta tissue\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: mouse liver tissue, human hepatocirrhosis tissue,  human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7448 Product name: Recombinant human URM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-101 aa of BC003581 Sequence: MAAPLSVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSVLFISTLHGG Predict reactive species\nFull Name: ubiquitin related modifier 1 homolog (S. cerevisiae)\nCalculated Molecular Weight: 11 kDa\nObserved Molecular Weight: 11 kDa\nGenBank Accession Number: BC003581\nGene Symbol: URM1\nGene ID (NCBI): 81605\nRRID: AB_2213808\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BTM9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869626224809,"sku":"15285-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15285-1-ap","provider":"Iright","version":"1.0","type":"link"}