{"product_id":"proteintech-15293-1-ap","title":"Proteintech, 15293-1-AP, ARFGAP3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARFGAP3 (15293-1-AP) by Proteintech is a Polyclonal antibody targeting ARFGAP3 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n15293-1-AP targets ARFGAP3 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, mouse brain tissue,  Jurkat cells\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells, HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nARFGAP3, also named as ADP-ribosylation factor GTPase-activating protein 3, is a 516 amino acid protein, which is Widely expressed with Highest expression in endocrine glands (pancreas, pituitary gland, salivary gland, and prostate). ARFGAP3 is a GTPase-activating protein (GAP) for ADP ribosylation factor 1 (ARF1). Hydrolysis of ARF1-bound GTP may lead to dissociation of coatomer from Golgi-derived membranes to allow fusion with target membranes. The calculated molecular weight of ARFGAP3 is 57 kDa, but modified ARFGAP3 is about 57-66 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7536 Product name: Recombinant human ARFGAP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-346 aa of BC005122 Sequence: MGDPSKQDILTIFKRLRSVPTNKVCFDCGAKNPSWASITYGVFLCIDCSGSHRSLGVHLSFIRSTELDSNWSWFQLRCMQVGGNASASSFFHQHGCSTNDTNAKYNSRAAQLYREKIKSLASQATRKHGTDLWLDSCVVPPLSPPPKEEDFFASHVSPEVSDTAWASAIAEPSSLTSRPVETTLENNEGGQEQGPSVEGLNVPTKATLEVSSIIKKKPNQAKKGLGAKKGSLGAQKLANTCFNEIEKQAQAADKMKEQEDLAKVVSKEESIVSSLRLAYKDLEIQMKKDEKMNISGKKNVDSDRLGMGFGNCRSVISHSVTSDMQTIEQESPIMAKPRKKYNDDSD Predict reactive species\nFull Name: ADP-ribosylation factor GTPase activating protein 3\nCalculated Molecular Weight: 57 kDa\nObserved Molecular Weight: 57-66 kDa\nGenBank Accession Number: BC005122\nGene Symbol: ARFGAP3\nGene ID (NCBI): 26286\nRRID: AB_10804035\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NP61\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868992655529,"sku":"15293-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-15293-1-ap","provider":"Iright","version":"1.0","type":"link"}